Lineage for d4hhhd2 (4hhh D:150-469)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2078560Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2088460Superfamily c.1.14: RuBisCo, C-terminal domain [51649] (2 families) (S)
    automatically mapped to Pfam PF00016
  5. 2088461Family c.1.14.1: RuBisCo, large subunit, C-terminal domain [51650] (2 protein domains)
    N-terminal domain is alpha+beta
  6. 2088660Protein automated matches [226984] (9 species)
    not a true protein
  7. 2088734Species Pea (Pisum sativum) [TaxId:3888] [226514] (2 PDB entries)
  8. 2088742Domain d4hhhd2: 4hhh D:150-469 [202430]
    Other proteins in same PDB: d4hhha1, d4hhhb1, d4hhhc1, d4hhhd1, d4hhhs_, d4hhht_, d4hhhu_, d4hhhv_
    automated match to d1gk8a1
    complexed with rub

Details for d4hhhd2

PDB Entry: 4hhh (more details), 2.2 Å

PDB Description: Structure of Pisum sativum Rubisco
PDB Compounds: (D:) ribulose bisphosphate carboxylase large chain

SCOPe Domain Sequences for d4hhhd2:

Sequence; same for both SEQRES and ATOM records: (download)

>d4hhhd2 c.1.14.1 (D:150-469) automated matches {Pea (Pisum sativum) [TaxId: 3888]}
gpphgiqverdklnkygrpllgctikpklglsaknygravyeclrggldftkddenvnsq
pfmrwrdrflfcaeaiyksqaetgeikghylnatagtceemlkravfarelgvpivmhdy
ltggftanttlshycrdnglllhihramhavidrqknhgmhfrvlakalrlsggdhihag
tvvgklegereitlgfvdllrddyikkdrsrgiyftqdwvslpgvipvasggihvwhmpa
lteifgddsvlqfgggtlghpwgnapgavanrvaleacvqarnegrdlaregnaiireac
kwspelaaacevwkeikfef

SCOPe Domain Coordinates for d4hhhd2:

Click to download the PDB-style file with coordinates for d4hhhd2.
(The format of our PDB-style files is described here.)

Timeline for d4hhhd2: