Class b: All beta proteins [48724] (93 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (14 superfamilies) |
Superfamily b.1.1: Immunoglobulin [48726] (5 families) |
Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (12 proteins) |
Protein Immunoglobulin (variable domains of L and H chains) [48749] (183 species) |
Species Fab TP7 (mouse), kappa L chain [48850] (2 PDB entries) |
Domain d1ay1h1: 1ay1 H:1-115 [20243] Other proteins in same PDB: d1ay1h2, d1ay1l2 |
PDB Entry: 1ay1 (more details), 2.2 Å
SCOP Domain Sequences for d1ay1h1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ay1h1 b.1.1.1 (H:1-115) Immunoglobulin (variable domains of L and H chains) {Fab TP7 (mouse), kappa L chain} evqlqesgpglvkpyqslslsctvtgysitsdyawnwirqfpgnklewmgyitysgttdy npslksrisitrdtsknqfflqlnsvttedtatyycaryyygywyfdvwgqgttltvss
Timeline for d1ay1h1: