Lineage for d1ay1h1 (1ay1 H:1-115)

  1. Root: SCOP 1.55
  2. 6992Class b: All beta proteins [48724] (93 folds)
  3. 6993Fold b.1: Immunoglobulin-like beta-sandwich [48725] (14 superfamilies)
  4. 6994Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 6995Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (12 proteins)
  6. 7065Protein Immunoglobulin (variable domains of L and H chains) [48749] (183 species)
  7. 7862Species Fab TP7 (mouse), kappa L chain [48850] (2 PDB entries)
  8. 7863Domain d1ay1h1: 1ay1 H:1-115 [20243]
    Other proteins in same PDB: d1ay1h2, d1ay1l2

Details for d1ay1h1

PDB Entry: 1ay1 (more details), 2.2 Å

PDB Description: anti taq fab tp7

SCOP Domain Sequences for d1ay1h1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ay1h1 b.1.1.1 (H:1-115) Immunoglobulin (variable domains of L and H chains) {Fab TP7 (mouse), kappa L chain}
evqlqesgpglvkpyqslslsctvtgysitsdyawnwirqfpgnklewmgyitysgttdy
npslksrisitrdtsknqfflqlnsvttedtatyycaryyygywyfdvwgqgttltvss

SCOP Domain Coordinates for d1ay1h1:

Click to download the PDB-style file with coordinates for d1ay1h1.
(The format of our PDB-style files is described here.)

Timeline for d1ay1h1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1ay1h2