SCOPe 2.06: Domain d4hhhd1: 4hhh D:12-149

Lineage for d4hhhd1 (4hhh D:12-149)

1. Root: SCOPe 2.06

2. Class d: Alpha and beta proteins (a+b) [53931] (385 folds)

3. Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
   alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2

4. Superfamily d.58.9: RuBisCO, large subunit, small (N-terminal) domain [54966] (2 families)
   C-terminal domain is beta/alpha barrel

5. Family d.58.9.0: automated matches [227234] (1 protein)
   not a true family

6. Protein automated matches [226983] (18 species)
   not a true protein

7. Species Pea (Pisum sativum) [TaxId:3888] [226513] (2 PDB entries)

8. Domain d4hhhd1: 4hhh D:12-149 [202429]
   Other proteins in same PDB: d4hhha2, d4hhhb2, d4hhhc2, d4hhhd2, d4hhhs_, d4hhht_, d4hhhu_, d4hhhv_
   automated match to d1gk8a2
   complexed with rub

Details for d4hhhd1

PDB Entry: 4hhh, 2.2 Å

PDB Description: Structure of Pisum sativum Rubisco

PDB Compounds: (D:) ribulose bisphosphate carboxylase large chain

SCOPe Domain Sequences for d4hhhd1:

Sequence; same for both SEQRES and ATOM records:

>d4hhhd1 d.58.9.0 (D:12-149) automated matches {Pea (Pisum sativum) [TaxId: 3888]}
gfkagvkdykltyytpdyqtkdtdilaafrvtpqpgvppeeagaavaaesstgtwttvwt
dgltsldrykgrcyeiepvpgednqfiayvaypldlfeegsvtnmftsivgnvfgfkalr
alrledlripyayvktfq

Timeline for d4hhhd1:

• d4hhhd1 first appeared in SCOPe 2.03
  
• d4hhhd1 appears in SCOPe 2.05
  
• d4hhhd1 appears in SCOPe 2.07
  
• d4hhhd1 appears in the current release, SCOPe 2.08