![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.1: TIM beta/alpha-barrel [51350] (34 superfamilies) contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678 the first seven superfamilies have similar phosphate-binding sites |
![]() | Superfamily c.1.14: RuBisCo, C-terminal domain [51649] (2 families) ![]() automatically mapped to Pfam PF00016 |
![]() | Family c.1.14.1: RuBisCo, large subunit, C-terminal domain [51650] (2 proteins) N-terminal domain is alpha+beta |
![]() | Protein automated matches [226984] (16 species) not a true protein |
![]() | Species Pea (Pisum sativum) [TaxId:3888] [226514] (2 PDB entries) |
![]() | Domain d4hhhb2: 4hhh B:150-469 [202426] Other proteins in same PDB: d4hhha1, d4hhhb1, d4hhhc1, d4hhhd1, d4hhhs_, d4hhht_, d4hhhu_, d4hhhv_ automated match to d1gk8a1 complexed with rub |
PDB Entry: 4hhh (more details), 2.2 Å
SCOPe Domain Sequences for d4hhhb2:
Sequence; same for both SEQRES and ATOM records: (download)
>d4hhhb2 c.1.14.1 (B:150-469) automated matches {Pea (Pisum sativum) [TaxId: 3888]} gpphgiqverdklnkygrpllgctikpklglsaknygravyeclrggldftkddenvnsq pfmrwrdrflfcaeaiyksqaetgeikghylnatagtceemlkravfarelgvpivmhdy ltggftanttlshycrdnglllhihramhavidrqknhgmhfrvlakalrlsggdhihag tvvgklegereitlgfvdllrddyikkdrsrgiyftqdwvslpgvipvasggihvwhmpa lteifgddsvlqfgggtlghpwgnapgavanrvaleacvqarnegrdlaregnaiireac kwspelaaacevwkeikfef
Timeline for d4hhhb2: