Lineage for d4hg9a_ (4hg9 A:)

  1. Root: SCOPe 2.03
  2. 1253684Class a: All alpha proteins [46456] (284 folds)
  3. 1282888Fold a.133: Phospholipase A2, PLA2 [48618] (1 superfamily)
    common core: 2 helices, disulfide-linked, and a calcium-binding loop
  4. 1282889Superfamily a.133.1: Phospholipase A2, PLA2 [48619] (4 families) (S)
  5. 1282894Family a.133.1.2: Vertebrate phospholipase A2 [48623] (3 proteins)
    automatically mapped to Pfam PF00068
  6. 1283246Protein automated matches [190139] (24 species)
    not a true protein
  7. 1283321Species Halys viper (Agkistrodon halys) [TaxId:8714] [194477] (1 PDB entry)
  8. 1283322Domain d4hg9a_: 4hg9 A: [202417]
    automated match to d4hg9c_
    complexed with ca, cit, g3p, gol

Details for d4hg9a_

PDB Entry: 4hg9 (more details), 1.6 Å

PDB Description: Crystal structure of AhV_bPA, a basic PLA2 from Agkistrodon halys pallas venom
PDB Compounds: (A:) Basic phospholipase A2 B

SCOPe Domain Sequences for d4hg9a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4hg9a_ a.133.1.2 (A:) automated matches {Halys viper (Agkistrodon halys) [TaxId: 8714]}
hllqfrkmikkmtgkepvvsyafygcycgsggrgkpkdatdrccfvhdccyekvtgcdpk
wddytyswkdgdivcggddpckkevcecdkaaaicfrdnlktykkrymaypdilcsskse
kc

SCOPe Domain Coordinates for d4hg9a_:

Click to download the PDB-style file with coordinates for d4hg9a_.
(The format of our PDB-style files is described here.)

Timeline for d4hg9a_: