Lineage for d4hdma_ (4hdm A:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2114880Fold c.39: Nicotinate mononucleotide:5,6-dimethylbenzimidazole phosphoribosyltransferase (CobT) [52732] (1 superfamily)
    3 layers: a/b/a, parallel beta-sheet of 7 strands, order 3214567
  4. 2114881Superfamily c.39.1: Nicotinate mononucleotide:5,6-dimethylbenzimidazole phosphoribosyltransferase (CobT) [52733] (2 families) (S)
  5. 2114927Family c.39.1.0: automated matches [193428] (1 protein)
    not a true family
  6. 2114928Protein automated matches [193429] (1 species)
    not a true protein
  7. 2114929Species Sporomusa ovata [TaxId:2378] [193430] (5 PDB entries)
  8. 2114936Domain d4hdma_: 4hdm A: [202414]
    automated match to d1l4na_
    complexed with edo, pcr

Details for d4hdma_

PDB Entry: 4hdm (more details), 1.95 Å

PDB Description: Crystal Structure of ArsAB in Complex with p-cresol
PDB Compounds: (A:) ArsA

SCOPe Domain Sequences for d4hdma_:

Sequence, based on SEQRES records: (download)

>d4hdma_ c.39.1.0 (A:) automated matches {Sporomusa ovata [TaxId: 2378]}
sllqatvakimrpdtvikdqvktklagvlqsagslgrledmveqyagitgelnpalpkpc
mvvasadhgvarrvvsaypiettihmtanylisqgasanafanfcgadmvvvdmgvagdl
syvpglwhrkiaygtqdftegpamtreqaiqavetgidivndrvkhgnrcfclgemgign
ttssativgaftglapekvtgrgtgisdsrlktkmeivgralavnkpnpqdgldvlakvg
gfelgalagvilgsaanrcavvidglnttaaalianvihplskeymfashlsgepahsia
lrqlqleaclelgvrlgegigasmvvdmlyvaikllnnrg

Sequence, based on observed residues (ATOM records): (download)

>d4hdma_ c.39.1.0 (A:) automated matches {Sporomusa ovata [TaxId: 2378]}
sllqatvakimrpdtvikdqvktklagvlqsagslgrledmveqyagitgelnpalpkpc
mvvasadhgvarrvvsaypiettihmtanylisqgasanafanfcgadmvvvdmgvagdl
syvpglwhrkiaygtqdftegpamtreqaiqavetgidivndrvkhgnrcfclgemgign
ttssativgaftglapekvtgrktkmeivgralavnkpnpqdgldvlakvggfelgalag
vilgsaanrcavvidglnttaaalianvihplskeymfashlsgepahsialrqlqleac
lelgvrlgegigasmvvdmlyvaikllnnrg

SCOPe Domain Coordinates for d4hdma_:

Click to download the PDB-style file with coordinates for d4hdma_.
(The format of our PDB-style files is described here.)

Timeline for d4hdma_: