Lineage for d4hbmg_ (4hbm G:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2712363Fold a.42: SWIB/MDM2 domain [47591] (1 superfamily)
    core: 4 helices: open bundle; capped by two small 3-stranded beta-sheets
    duplication: consists of two structural repeats
  4. 2712364Superfamily a.42.1: SWIB/MDM2 domain [47592] (2 families) (S)
    binds to the transactivation domain of human p53
  5. 2712365Family a.42.1.1: SWIB/MDM2 domain [47593] (5 proteins)
    Pfam PF02201
  6. 2712372Protein MDM2 [47594] (2 species)
  7. 2712390Species Human (Homo sapiens) [TaxId:9606] [47596] (76 PDB entries)
  8. 2712427Domain d4hbmg_: 4hbm G: [202410]
    automated match to d4hbme_
    complexed with 0y7

Details for d4hbmg_

PDB Entry: 4hbm (more details), 1.9 Å

PDB Description: Ordering of the N Terminus of Human MDM2 by Small Molecule Inhibitors
PDB Compounds: (G:) E3 ubiquitin-protein ligase Mdm2

SCOPe Domain Sequences for d4hbmg_:

Sequence, based on SEQRES records: (download)

>d4hbmg_ a.42.1.1 (G:) MDM2 {Human (Homo sapiens) [TaxId: 9606]}
svptdgavttsqipaseqetlvrpkplllkllksvgaqkdtytmkevlfylgqyimtkrl
ydekqqhivycsndllgdlfgvpsfsvkehrkiytmiyrnlvvvn

Sequence, based on observed residues (ATOM records): (download)

>d4hbmg_ a.42.1.1 (G:) MDM2 {Human (Homo sapiens) [TaxId: 9606]}
svptdgavttsqipaseqetlvrpkplllkllksvgaqkdtytmkevlfylgqyimtkrl
yhivycsndllgdlfgvpsfsvkehrkiytmiyrnlvvvn

SCOPe Domain Coordinates for d4hbmg_:

Click to download the PDB-style file with coordinates for d4hbmg_.
(The format of our PDB-style files is described here.)

Timeline for d4hbmg_: