| Class b: All beta proteins [48724] (119 folds) |
| Fold b.1: Immunoglobulin-like beta-sandwich [48725] (20 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (4 families) ![]() |
| Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (15 proteins) |
| Protein Immunoglobulin (variable domains of L and H chains) [48749] (228 species) |
| Species Diels-Alder catalytic Fab 13G5 (mouse), kappa L chain [48849] (1 PDB entry) |
| Domain d1a3lh1: 1a3l H:1-113 [20241] Other proteins in same PDB: d1a3lh2, d1a3ll2 complexed with cfc |
PDB Entry: 1a3l (more details), 1.95 Å
SCOP Domain Sequences for d1a3lh1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1a3lh1 b.1.1.1 (H:1-113) Immunoglobulin (variable domains of L and H chains) {Diels-Alder catalytic Fab 13G5 (mouse), kappa L chain}
evqleesgpelvrpgtsvkisckasgytftnywlgwvkqrpghgfewigdiypggvyttn
nekfrgkailtadtssstaymqlssltsedsavyfcaraggyytggdywgqgtsvtvss
Timeline for d1a3lh1: