SCOPe 2.08: Domain d4hapa1: 4hap A:24-453

Lineage for d4hapa1 (4hap A:24-453)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily)
   sandwich; 12-14 strands in 2 sheets; complex topology

4. Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (27 families)

5. Family b.29.1.10: Glycosyl hydrolase family 7 catalytic core [49971] (2 proteins)
   contains many insertions in the common fold
   automatically mapped to Pfam PF00840

6. Protein automated matches [190170] (17 species)
   not a true protein

7. Species Limnoria quadripunctata [TaxId:161573] [197311] (4 PDB entries)

8. Domain d4hapa1: 4hap A:24-453 [202400]
   Other proteins in same PDB: d4hapa2, d4hapb2
   automated match to d4hapb_
   complexed with ca, trs

Details for d4hapa1

PDB Entry: 4hap, 1.6 Å

PDB Description: crystal structure of a gh7 family cellobiohydrolase from limnoria quadripunctata in complex with cellobiose

PDB Compounds: (A:) GH7 family protein

SCOPe Domain Sequences for d4hapa1:

Sequence; same for both SEQRES and ATOM records:

>d4hapa1 b.29.1.10 (A:24-453) automated matches {Limnoria quadripunctata [TaxId: 161573]}
qagteteeyhlpltwerdgssvsasvvidsnwrwthstedttncydgnewdstlcpdadt
ctencaidgvdqgtwgdtygitasgskltlsfvtegeystdigsrvflmadddnyeifnl
ldkefsfdvdasnlpcglngalyfvsmdedggtskystntagakygtgycdaqcphdmkf
iagkansdgwtpsdndqnagtgemgacchemdiweansqaqsytahvcsvdgytpctgtd
cgdngddrykgvcdkdgcdyaayrlgqhdfygeggtvdsgstltvitqfitgggglneir
riyqqggqtiqnaavnfpgdvdpydsitedfcvdikryfgdtndfdakggmsgmsnalkk
gmvlvmslwddhyanmlwldatypvdstepgalrgpcstdsgdpadveanfpgstvtfsn
ikigpiqsyd

Timeline for d4hapa1:

• d4hapa1 first appeared in SCOPe 2.03, called d4hapa_
  
• d4hapa1 appears in SCOPe 2.07