SCOPe 2.03: Domain d4h9lh2: 4h9l H:36-248

Lineage for d4h9lh2 (4h9l H:36-248)

1. Root: SCOPe 2.03

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.41: PRC-barrel domain [50345] (1 superfamily)
   core: barrel, partly opened; n*=5, S*=8; meander

4. Superfamily b.41.1: PRC-barrel domain [50346] (5 families)

5. Family b.41.1.1: Photosynthetic reaction centre, H-chain, cytoplasmic domain [50347] (2 proteins)

6. Protein Photosynthetic reaction centre [50348] (3 species)

7. Species Rhodobacter sphaeroides [TaxId:1063] [50350] (78 PDB entries)
   Uniprot P11846

8. Domain d4h9lh2: 4h9l H:36-248 [202392]
   Other proteins in same PDB: d4h9lh1, d4h9ll_, d4h9lm_
   automated match to d1qovh1
   complexed with bcl, bph, fe, spo, u10

Details for d4h9lh2

PDB Entry: 4h9l, 2.77 Å

PDB Description: bacterial photosynthetic reaction center from rhodobacter sphaeroides with ile m265 replaced with ser

PDB Compounds: (H:) reaction center protein h chain

SCOPe Domain Sequences for d4h9lh2:

Sequence; same for both SEQRES and ATOM records:

>d4h9lh2 b.41.1.1 (H:36-248) Photosynthetic reaction centre {Rhodobacter sphaeroides [TaxId: 1063]}
mregyplenedgtpaanqgpfplpkpktfilphgrgtltvpgpesedrpialartavseg
fphaptgdpmkdgvgpaswvarrdlpeldghghnkikpmkaaagfhvsagknpiglpvrg
cdleiagkvvdiwvdipeqmarflevelkdgstrllpmqmvkvqsnrvhvnalssdlfag
iptiksptevtlleedkicgyvagglmyaapkr

Timeline for d4h9lh2:

• d4h9lh2 is new in SCOPe 2.03-stable
  
• d4h9lh2 appears in SCOPe 2.04
  
• d4h9lh2 appears in the current release, SCOPe 2.08