SCOP 1.55: Domain d1c1eh1: 1c1e H:1-119

Lineage for d1c1eh1 (1c1e H:1-119)

1. Root: SCOP 1.55

2. Class b: All beta proteins [48724] (93 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (14 superfamilies)

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (12 proteins)

6. Protein Immunoglobulin (variable domains of L and H chains) [48749] (183 species)

7. Species Diels alder catalytic Fab 1E9 (mouse), kappa L chain [48848] (1 PDB entry)

8. Domain d1c1eh1: 1c1e H:1-119 [20239]
   Other proteins in same PDB: d1c1eh2, d1c1el2

Details for d1c1eh1

PDB Entry: 1c1e, 1.9 Å

PDB Description: crystal structure of a diels-alderase catalytic antibody 1e9 in complex with its hapten

SCOP Domain Sequences for d1c1eh1:

Sequence; same for both SEQRES and ATOM records:

>d1c1eh1 b.1.1.1 (H:1-119) Immunoglobulin (variable domains of L and H chains) {Diels alder catalytic Fab 1E9 (mouse), kappa L chain}
qiqlvqsgpelkkpgetvkisckasgymftnygmnwvkqapgkalklmgwinpytgestf
addfkgrfaffletsattaylqinnlknedmatyfcargttivramdywgqgtsltvssa
kttpp

Timeline for d1c1eh1:

• d1c1eh1 appears in SCOP 1.57
  
• d1c1eh1 appears in the current release, SCOPe 2.08