Lineage for d4h6bj_ (4h6b J:)

  1. Root: SCOPe 2.03
  2. 1287432Class b: All beta proteins [48724] (174 folds)
  3. 1336535Fold b.159: AOC barrel-like [141492] (2 superfamilies)
    barrel, closed; n=8, S=10; meander; mirrored (reversed) topology to the Spreptavidin-like and Lipocalin-like folds
  4. 1336536Superfamily b.159.1: Allene oxide cyclase-like [141493] (2 families) (S)
  5. 1336537Family b.159.1.1: Allene oxide cyclase-like [141494] (2 proteins)
    Pfam PF06351
  6. 1336558Protein automated matches [190385] (2 species)
    not a true protein
  7. 1336559Species Physcomitrella patens [TaxId:3218] [193452] (2 PDB entries)
  8. 1336581Domain d4h6bj_: 4h6b J: [202382]
    automated match to d4h6bb_
    complexed with 10x, 10y, hez, po4

Details for d4h6bj_

PDB Entry: 4h6b (more details), 1.35 Å

PDB Description: structural basis for allene oxide cyclization in moss
PDB Compounds: (J:) allene oxide cyclase

SCOPe Domain Sequences for d4h6bj_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4h6bj_ b.159.1.1 (J:) automated matches {Physcomitrella patens [TaxId: 3218]}
hvqelfvyeinerdrgspvflpfggkkqpgtdahvnslgdlvpfsnkiydgslktrlgit
aglctlishsdqkngdryealysfyfgdyghisvqgpyityedsylaitggsgifagcyg
qaklhqiifpfklfytfylqgikklpealcapcvppspsvapadeakqclpnhvapnftk

SCOPe Domain Coordinates for d4h6bj_:

Click to download the PDB-style file with coordinates for d4h6bj_.
(The format of our PDB-style files is described here.)

Timeline for d4h6bj_: