Lineage for d1c1el1 (1c1e L:1-112)

  1. Root: SCOP 1.73
  2. 651986Class b: All beta proteins [48724] (165 folds)
  3. 651987Fold b.1: Immunoglobulin-like beta-sandwich [48725] (27 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 651988Superfamily b.1.1: Immunoglobulin [48726] (4 families) (S)
  5. 651989Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (29 proteins)
  6. 652980Protein Immunoglobulin light chain kappa variable domain, VL-kappa [88519] (14 species)
    VL-kappa domains of human and mouse antibodies are clustered by the sequence similarity within the germline encoded segment and then by the size of the complementarity determining regions CDR1 and CDR2, so the clusters may correspond to putative germline families in the species genomes; VL-kappa domains with artificial or grafted exogenous CDRs are listed as engineered species
  7. 653172Species Mouse (Mus musculus), cluster 1.1 [TaxId:10090] [88524] (127 PDB entries)
  8. 653232Domain d1c1el1: 1c1e L:1-112 [20238]
    Other proteins in same PDB: d1c1eh1, d1c1eh2, d1c1el2
    part of Diels-Alder catalytic Fab 1E9
    complexed with dmr, enh

Details for d1c1el1

PDB Entry: 1c1e (more details), 1.9 Å

PDB Description: crystal structure of a diels-alderase catalytic antibody 1e9 in complex with its hapten
PDB Compounds: (L:) catalytic antibody 1e9 (light chain)

SCOP Domain Sequences for d1c1el1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1c1el1 b.1.1.1 (L:1-112) Immunoglobulin light chain kappa variable domain, VL-kappa {Mouse (Mus musculus), cluster 1.1 [TaxId: 10090]}
elvmtqtplslpvslgdqasiscrssqslvhsngntylhwylqkpgqspkfliykvsnrf
sgvpdrfggsgsgtdfilkisrveaedlgvyfcfqsthffptfgggtkleiksadaa

SCOP Domain Coordinates for d1c1el1:

Click to download the PDB-style file with coordinates for d1c1el1.
(The format of our PDB-style files is described here.)

Timeline for d1c1el1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1c1el2