SCOPe 2.08: Domain d4h6af1: 4h6a F:1-188

Lineage for d4h6af1 (4h6a F:1-188)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.159: AOC barrel-like [141492] (2 superfamilies)
   barrel, closed; n=8, S=10; meander; mirrored (reversed) topology to the Spreptavidin-like and Lipocalin-like folds

4. Superfamily b.159.1: Allene oxide cyclase-like [141493] (2 families)

5. Family b.159.1.0: automated matches [193448] (1 protein)
   not a true family

6. Protein automated matches [193449] (1 species)
   not a true protein

7. Species Physcomitrella patens [TaxId:145481] [193450] (2 PDB entries)

8. Domain d4h6af1: 4h6a F:1-188 [202374]
   Other proteins in same PDB: d4h6aa2, d4h6ab2, d4h6ac2, d4h6ad2, d4h6ae2, d4h6af2
   automated match to d4h6ab_
   complexed with ipa, mpd, mrd, so4

Details for d4h6af1

PDB Entry: 4h6a, 1.95 Å

PDB Description: crystal structure of the allene oxide cyclase 2 from physcomitrella patens

PDB Compounds: (F:) allene oxide cyclase

SCOPe Domain Sequences for d4h6af1:

Sequence, based on SEQRES records:

>d4h6af1 b.159.1.0 (F:1-188) automated matches {Physcomitrella patens [TaxId: 145481]}
mgnkvdklagvqelsvyeinerdrgspvilpfggkkdengahanslgdlvpfsnkvydgs
lqrrlgitagictlishnaekkgdryeaqysfyfgdyghisvqgpyityedtelvvtggt
gifagchgvaklhqiifpvklfytfylqgikklpeelcasvvppspsaepseqakkchps
svapnftn

Sequence, based on observed residues (ATOM records):

>d4h6af1 b.159.1.0 (F:1-188) automated matches {Physcomitrella patens [TaxId: 145481]}
mgnkvdklagvqelsvyeinerdrgspvilpslgdlvpfsnkvydgslqrrlgitagict
lishnaekkgdryeaqysfyfgdyghisvqgpyityedtelvvtggtgifagchgvaklh
qiifpvklfytfylqgikklpeelcasvvppspsaepseqakkchpssvapnftn

Timeline for d4h6af1:

• d4h6af1 first appeared in SCOPe 2.03, called d4h6af_
  
• d4h6af1 appears in SCOPe 2.07