Lineage for d1a4kb1 (1a4k B:1-119)

  1. Root: SCOP 1.61
  2. 157351Class b: All beta proteins [48724] (111 folds)
  3. 157352Fold b.1: Immunoglobulin-like beta-sandwich [48725] (17 superfamilies)
  4. 157353Superfamily b.1.1: Immunoglobulin [48726] (6 families) (S)
  5. 157354Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (14 proteins)
  6. 157410Protein Immunoglobulin (variable domains of L and H chains) [48749] (222 species)
  7. 157782Species Diels-Alder catalytic Fab (mouse), kappa L chain [48847] (2 PDB entries)
  8. 157788Domain d1a4kb1: 1a4k B:1-119 [20237]
    Other proteins in same PDB: d1a4ka2, d1a4kb2, d1a4kh2, d1a4kl2

Details for d1a4kb1

PDB Entry: 1a4k (more details), 2.4 Å

PDB Description: diels alder catalytic antibody with transition state analogue

SCOP Domain Sequences for d1a4kb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1a4kb1 b.1.1.1 (B:1-119) Immunoglobulin (variable domains of L and H chains) {Diels-Alder catalytic Fab (mouse), kappa L chain}
qvqllesgpelkkpgetvkisckasgytftnygmnwvkqapgkglkwmgwintytgepty
addfkgrfafsletsastaylqinnlknedtatyfcvqaerlrrtfdywgagttvtvssa
stkgp

SCOP Domain Coordinates for d1a4kb1:

Click to download the PDB-style file with coordinates for d1a4kb1.
(The format of our PDB-style files is described here.)

Timeline for d1a4kb1: