Lineage for d4h52b_ (4h52 B:)

  1. Root: SCOPe 2.06
  2. 2017114Class b: All beta proteins [48724] (177 folds)
  3. 2064980Fold b.68: 6-bladed beta-propeller [50938] (11 superfamilies)
    consists of six 4-stranded beta-sheet motifs; meander
  4. 2064981Superfamily b.68.1: Sialidases [50939] (3 families) (S)
  5. 2064982Family b.68.1.1: Sialidases (neuraminidases) [50940] (10 protein domains)
  6. 2065266Protein automated matches [193245] (14 species)
    not a true protein
  7. 2065304Species Influenza a virus [TaxId:382827] [193246] (9 PDB entries)
  8. 2065314Domain d4h52b_: 4h52 B: [202366]
    automated match to d4h52a_
    complexed with ca, fsi

Details for d4h52b_

PDB Entry: 4h52 (more details), 1.8 Å

PDB Description: Wild-type influenza N2 neuraminidase covalent complex with 3-fluoro-Neu5Ac
PDB Compounds: (B:) Neuraminidase

SCOPe Domain Sequences for d4h52b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4h52b_ b.68.1.1 (B:) automated matches {Influenza a virus [TaxId: 382827]}
veyrnwskpqcqitgfapfskdnsirlsaggdiwvtrepyvscdpgkcyqfalgqgttld
nkhsndtvhdriphrtllmnelgvpfhlgtrqvciawsssschdgkawlhvcitgddkna
tasfiydgrlvdsigswsqnilrtqesecvcingtctvvmtdgsasgradtrilfieegk
ivhisplsgsaqhieecscyprypgvrcicrdnwkgsnrpvvdinmedysidssyvcsgl
vgdtprnddsssnsncrnpnnergtqgvkgwafdngndlwmgrtiskesrsgyetfkvig
gwstpnsksqvnrqvivdnnnwsgysgifsvegkscinrcfyvelirgrpqetrvwwtsn
sivvfcgtsgtygtgswpdganinfmpi

SCOPe Domain Coordinates for d4h52b_:

Click to download the PDB-style file with coordinates for d4h52b_.
(The format of our PDB-style files is described here.)

Timeline for d4h52b_: