Lineage for d4h4gg_ (4h4g G:)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2187707Fold d.38: Thioesterase/thiol ester dehydrase-isomerase [54636] (1 superfamily)
    core: beta-alpha-beta(4); 2 layers: alpha/beta
  4. 2187708Superfamily d.38.1: Thioesterase/thiol ester dehydrase-isomerase [54637] (9 families) (S)
  5. 2188470Family d.38.1.0: automated matches [191325] (1 protein)
    not a true family
  6. 2188471Protein automated matches [190143] (36 species)
    not a true protein
  7. 2188501Species Burkholderia thailandensis [TaxId:271848] [193479] (1 PDB entry)
  8. 2188508Domain d4h4gg_: 4h4g G: [202364]
    automated match to d4h4gi_

Details for d4h4gg_

PDB Entry: 4h4g (more details), 2.65 Å

PDB Description: Crystal Structure of (3R)-hydroxymyristoyl-[acyl-carrier-protein] dehydratase from Burkholderia thailandensis E264
PDB Compounds: (G:) (3R)-hydroxymyristoyl-[acyl-carrier-protein] dehydratase

SCOPe Domain Sequences for d4h4gg_:

Sequence, based on SEQRES records: (download)

>d4h4gg_ d.38.1.0 (G:) automated matches {Burkholderia thailandensis [TaxId: 271848]}
infdihkiltllphrypillvdrvlelephksikalknvtvnepfftghfpkrpvmpgvl
iiealaqaaalltfaeaepkdpentlyyfvgidnarfkrvvepgdqlilnvtferyirgi
wkfkavaevdgkvaaeaelmctvkt

Sequence, based on observed residues (ATOM records): (download)

>d4h4gg_ d.38.1.0 (G:) automated matches {Burkholderia thailandensis [TaxId: 271848]}
infdihkiltllphrypillvdrvlelephksikalknvtvnepfftghfpkrpvmpgvl
iiealaqaaalltfaeatlyyfvgidnarfkrvvepgdqlilnvtferyirgiwkfkava
evdgkvaaeaelmctvkt

SCOPe Domain Coordinates for d4h4gg_:

Click to download the PDB-style file with coordinates for d4h4gg_.
(The format of our PDB-style files is described here.)

Timeline for d4h4gg_: