Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.1: TIM beta/alpha-barrel [51350] (34 superfamilies) contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678 the first seven superfamilies have similar phosphate-binding sites |
Superfamily c.1.10: Aldolase [51569] (9 families) Common fold covers whole protein structure |
Family c.1.10.0: automated matches [191319] (1 protein) not a true family |
Protein automated matches [190115] (94 species) not a true protein |
Species Clostridium difficile [TaxId:272563] [189051] (2 PDB entries) |
Domain d4h3db_: 4h3d B: [202353] Other proteins in same PDB: d4h3dd2 automated match to d4h3dd_ complexed with act, peg, pge, shl |
PDB Entry: 4h3d (more details), 1.95 Å
SCOPe Domain Sequences for d4h3db_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4h3db_ c.1.10.0 (B:) automated matches {Clostridium difficile [TaxId: 272563]} mkrkvqvknitigegrpkicvpiigknkkdiikeakelkdacldiiewrvdffenvenik evkevlyelrsyihdipllftfrsvveggeklisrdyyttlnkeisntglvdlidvelfm gdevidevvnfahkkevkviisnhdfnktpkkeeivsrlcrmqelgadlpkiavmpqnek dvlvlleatnemfkiyadrpiitmsmsgmgvisrlcgeifgsaltfgaaksvsapgqisf kelnsvlnllhksi
Timeline for d4h3db_:
View in 3D Domains from other chains: (mouse over for more information) d4h3da_, d4h3dc_, d4h3dd1, d4h3dd2 |