Lineage for d1a4kh1 (1a4k H:1-119)

  1. Root: SCOP 1.71
  2. 546417Class b: All beta proteins [48724] (149 folds)
  3. 546418Fold b.1: Immunoglobulin-like beta-sandwich [48725] (25 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 546419Superfamily b.1.1: Immunoglobulin [48726] (4 families) (S)
  5. 546420Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (28 proteins)
  6. 546556Protein Immunoglobulin heavy chain variable domain, VH [88543] (20 species)
    VH domains of human and mouse antibodies are clustered by the sequence similarity within the germline encoded segment and then by the size of the complementarity determining regions CDR1 and CDR2, so the clusters may correspond to putative germline families in the species genomes; VH domains with artificial or grafted exogenous CDRs are listed as engineered species
  7. 547079Species Mouse (Mus musculus), cluster 4 [TaxId:10090] [88554] (32 PDB entries)
  8. 547100Domain d1a4kh1: 1a4k H:1-119 [20235]
    Other proteins in same PDB: d1a4ka1, d1a4ka2, d1a4kb2, d1a4kh2, d1a4kl1, d1a4kl2

Details for d1a4kh1

PDB Entry: 1a4k (more details), 2.4 Å

PDB Description: diels alder catalytic antibody with transition state analogue

SCOP Domain Sequences for d1a4kh1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1a4kh1 b.1.1.1 (H:1-119) Immunoglobulin heavy chain variable domain, VH {Mouse (Mus musculus), cluster 4}
qvqllesgpelkkpgetvkisckasgytftnygmnwvkqapgkglkwmgwintytgepty
addfkgrfafsletsastaylqinnlknedtatyfcvqaerlrrtfdywgagttvtvssa
stkgp

SCOP Domain Coordinates for d1a4kh1:

Click to download the PDB-style file with coordinates for d1a4kh1.
(The format of our PDB-style files is described here.)

Timeline for d1a4kh1: