Lineage for d4h0nb_ (4h0n B:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2892669Fold c.66: S-adenosyl-L-methionine-dependent methyltransferases [53334] (1 superfamily)
    core: 3 layers, a/b/a; mixed beta-sheet of 7 strands, order 3214576; strand 7 is antiparallel to the rest
  4. 2892670Superfamily c.66.1: S-adenosyl-L-methionine-dependent methyltransferases [53335] (61 families) (S)
  5. 2894468Family c.66.1.0: automated matches [191451] (1 protein)
    not a true family
  6. 2894469Protein automated matches [190689] (87 species)
    not a true protein
  7. 2894635Species Fall armyworm (Spodoptera frugiperda) [TaxId:7108] [194322] (1 PDB entry)
  8. 2894637Domain d4h0nb_: 4h0n B: [202344]
    automated match to d4h0na_
    complexed with ca, sah; mutant

Details for d4h0nb_

PDB Entry: 4h0n (more details), 2.71 Å

PDB Description: crystal structure of spodoptera frugiperda dnmt2 e260a/e261a/k263a mutant
PDB Compounds: (B:) dnmt2

SCOPe Domain Sequences for d4h0nb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4h0nb_ c.66.1.0 (B:) automated matches {Fall armyworm (Spodoptera frugiperda) [TaxId: 7108]}
shkilelysgiggmhcawkesgldgeivaavdintvansvykhnfpetnllnrniqqltp
qvikkwnvdtilmsppcqpftrngkylddndprtnsflyligildqldnvdyilmenvkg
fenstvrnlfidklkecnfiyqefllcpstvgvpnsrlryyctarrnnltwpfkrrdeii
trlpkdfgvphslesiieedvdekflvpekmlrcakvfdicyktskrsccftkaythyad
gtgsiftdkprevvqkcyaaaaqneiggekfvelfkelklryftpkevlmimcfpksynl
ptnismkqcyrllgnsvnvkvisellkilfe

SCOPe Domain Coordinates for d4h0nb_:

Click to download the PDB-style file with coordinates for d4h0nb_.
(The format of our PDB-style files is described here.)

Timeline for d4h0nb_: