Lineage for d4h0mc_ (4h0m C:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2685878Fold a.1: Globin-like [46457] (2 superfamilies)
    core: 6 helices; folded leaf, partly opened
  4. 2685879Superfamily a.1.1: Globin-like [46458] (5 families) (S)
  5. 2688849Family a.1.1.3: Phycocyanin-like phycobilisome proteins [46532] (7 proteins)
    oligomers of two different types of globin-like subunits containing two extra helices at the N-terminus
    binds a bilin chromophore
    automatically mapped to Pfam PF00502
  6. 2689048Protein automated matches [190531] (23 species)
    not a true protein
  7. 2689327Species Synechococcus elongatus [TaxId:1140] [193231] (2 PDB entries)
  8. 2689330Domain d4h0mc_: 4h0m C: [202325]
    automated match to d4h0me_
    complexed with cyc

Details for d4h0mc_

PDB Entry: 4h0m (more details), 2.2 Å

PDB Description: X-Ray Crystal Structure of Phycocyanin from Synechococcus elongatus sp. PCC 7942
PDB Compounds: (C:) C-phycocyanin alpha chain

SCOPe Domain Sequences for d4h0mc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4h0mc_ a.1.1.3 (C:) automated matches {Synechococcus elongatus [TaxId: 1140]}
sktplteavaaadsqgrflsstelqvafgrfrqaasglaaakalannadslvngaanavy
skfpyttstpgnnfastpegkakcardigyylrivtyalvaggtgpideyllagldeink
tfdlapswyvealkyikanhglsgdsrdeansyidylinals

SCOPe Domain Coordinates for d4h0mc_:

Click to download the PDB-style file with coordinates for d4h0mc_.
(The format of our PDB-style files is described here.)

Timeline for d4h0mc_: