Lineage for d4gxxe_ (4gxx E:)

  1. Root: SCOPe 2.05
  2. 1755445Class b: All beta proteins [48724] (176 folds)
  3. 1778087Fold b.19: Viral protein domain [49817] (1 superfamily)
    sandwich; 9 strands in 2 sheets; jelly-roll; form trimers
  4. 1778088Superfamily b.19.1: Viral protein domain [49818] (4 families) (S)
    forms homotrimers
  5. 1778135Family b.19.1.2: Influenza hemagglutinin headpiece [49823] (2 proteins)
  6. 1778136Protein Hemagglutinin [49824] (7 species)
    includes rudiment esterase domain
  7. 1778137Species Influenza a virus (a/brevig mission/1/1918(h1n1)) [TaxId:88776] [188803] (3 PDB entries)
  8. 1778140Domain d4gxxe_: 4gxx E: [202310]
    Other proteins in same PDB: d4gxxb_, d4gxxd_, d4gxxf_
    automated match to d4gxxc_
    complexed with nag

Details for d4gxxe_

PDB Entry: 4gxx (more details), 1.8 Å

PDB Description: Crystal structure of the "avianized" 1918 influenza virus hemagglutinin
PDB Compounds: (E:) Hemagglutinin HA1 chain

SCOPe Domain Sequences for d4gxxe_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4gxxe_ b.19.1.2 (E:) Hemagglutinin {Influenza a virus (a/brevig mission/1/1918(h1n1)) [TaxId: 88776]}
pgdticigyhannstdtvdtvleknvtvthsvnlledshngklcklkgiaplqlgkcnia
gwllgnpecdllltasswsyivetsnsengtcypgdfidyeelreqlssvssfekfeifp
ktsswpnhettkgvtaacsyagassfyrnllwltkkgssypklsksyvnnkgkevlvlwg
vhhpptgteqqslyqnadayvsvgsskynrrftpeiaarpkvrgqagrmnyywtllepgd
titfeatgnliapwyafalnrgsgsgiitsdapvhdcntkcqtphgainsslpfqnihpv
tigecpkyvrstklrmatglrnips

SCOPe Domain Coordinates for d4gxxe_:

Click to download the PDB-style file with coordinates for d4gxxe_.
(The format of our PDB-style files is described here.)

Timeline for d4gxxe_: