![]() | Class b: All beta proteins [48724] (176 folds) |
![]() | Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
![]() | Superfamily b.1.1: Immunoglobulin [48726] (5 families) ![]() |
![]() | Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins) |
![]() | Protein Immunoglobulin heavy chain variable domain, VH [88543] (21 species) VH domains of human and mouse antibodies are clustered by the sequence similarity within the germline encoded segment and then by the size of the complementarity determining regions CDR1 and CDR2, so the clusters may correspond to putative germline families in the species genomes; VH domains with artificial or grafted exogenous CDRs are listed as engineered species |
![]() | Species Mouse (Mus musculus), cluster 4 [TaxId:10090] [88554] (34 PDB entries) Uniprot P06327 20-117 # HV52_MOUSE (P06327) Ig heavy chain V region VH558 A1/A4 precursor; 57% sequence identity ! Uniprot P01631 # KV2G_MOUSE (P01631) Ig kappa chain V-II region 26-10 |
![]() | Domain d1a4jh1: 1a4j H:1-119 [20231] Other proteins in same PDB: d1a4ja1, d1a4ja2, d1a4jb2, d1a4jh2, d1a4jl1, d1a4jl2 part of humanized Diels-Alder catalytic Fab |
PDB Entry: 1a4j (more details), 2.1 Å
SCOPe Domain Sequences for d1a4jh1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1a4jh1 b.1.1.1 (H:1-119) Immunoglobulin heavy chain variable domain, VH {Mouse (Mus musculus), cluster 4 [TaxId: 10090]} qvqllesgpelkkpgetvkisckasgytftnygmnwvkqapgkglkwmgwintytgepty addfkgrfafsletsastaylqinnlknedtatyfcvqaerlrrtfdywgagttvtvss
Timeline for d1a4jh1: