Lineage for d4gswb_ (4gsw B:)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2538334Fold d.15: beta-Grasp (ubiquitin-like) [54235] (14 superfamilies)
    core: beta(2)-alpha-beta(2); mixed beta-sheet 2143
  4. 2538335Superfamily d.15.1: Ubiquitin-like [54236] (11 families) (S)
  5. 2538336Family d.15.1.1: Ubiquitin-related [54237] (39 proteins)
    Pfam PF00240
  6. 2539528Protein automated matches [190118] (17 species)
    not a true protein
  7. 2539558Species Entamoeba (Entamoeba histolytica) [TaxId:5759] [193323] (2 PDB entries)
  8. 2539561Domain d4gswb_: 4gsw B: [202298]
    Other proteins in same PDB: d4gswa2
    automated match to d4gswa_
    complexed with so4

Details for d4gswb_

PDB Entry: 4gsw (more details), 2.15 Å

PDB Description: Crystal structure of ubiquitin from Entamoeba histolytica to 2.15 Angstrom
PDB Compounds: (B:) Ubiquitin

SCOPe Domain Sequences for d4gswb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4gswb_ d.15.1.1 (B:) automated matches {Entamoeba (Entamoeba histolytica) [TaxId: 5759]}
mqifvktltgktitlevepndsidaikakiqekegippdqqrlifagkqleegktlsdyn
iqkestlhlvlrl

SCOPe Domain Coordinates for d4gswb_:

Click to download the PDB-style file with coordinates for d4gswb_.
(The format of our PDB-style files is described here.)

Timeline for d4gswb_: