SCOPe 2.03: Domain d4gs7c1: 4gs7 C:32-129

Lineage for d4gs7c1 (4gs7 C:32-129)

1. Root: SCOPe 2.03

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.2: Fibronectin type III [49265] (2 families)

5. Family b.1.2.1: Fibronectin type III [49266] (45 proteins)
   Pfam PF00041

6. Protein Cytokine receptor common gamma chain [141041] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [141042] (4 PDB entries)
   Uniprot P31785 142-246! Uniprot P31785 142-248! Uniprot P31785 54-141! Uniprot P31785 56-141

8. Domain d4gs7c1: 4gs7 C:32-129 [202295]
   Other proteins in same PDB: d4gs7a_, d4gs7b1, d4gs7b2, d4gs7d_
   automated match to d2b5ic2
   complexed with act, edo, nag

Details for d4gs7c1

PDB Entry: 4gs7, 2.35 Å

PDB Description: structure of the interleukin-15 quaternary complex

PDB Compounds: (C:) Cytokine receptor common subunit gamma

SCOPe Domain Sequences for d4gs7c1:

Sequence; same for both SEQRES and ATOM records:

>d4gs7c1 b.1.2.1 (C:32-129) Cytokine receptor common gamma chain {Human (Homo sapiens) [TaxId: 9606]}
plplpevqcfvfnveymnctwqsssepqptnltlhywyknsdndkvqkcshylfseeits
gcqlqkkeihlyqtfvvqlqdpreprrqatqmlklqnl

Timeline for d4gs7c1:

• d4gs7c1 is new in SCOPe 2.03-stable
  
• d4gs7c1 appears in SCOPe 2.04
  
• d4gs7c1 appears in the current release, SCOPe 2.08