![]() | Class b: All beta proteins [48724] (180 folds) |
![]() | Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
![]() | Superfamily b.1.2: Fibronectin type III [49265] (2 families) ![]() |
![]() | Family b.1.2.1: Fibronectin type III [49266] (45 proteins) Pfam PF00041 |
![]() | Protein Cytokine receptor common gamma chain [141041] (1 species) |
![]() | Species Human (Homo sapiens) [TaxId:9606] [141042] (6 PDB entries) Uniprot P31785 142-246! Uniprot P31785 142-248! Uniprot P31785 54-141! Uniprot P31785 56-141 |
![]() | Domain d4gs7c1: 4gs7 C:33-129 [202295] Other proteins in same PDB: d4gs7a1, d4gs7a2, d4gs7b1, d4gs7b2, d4gs7c3, d4gs7d_ automated match to d2b5ic2 complexed with act, edo, nag |
PDB Entry: 4gs7 (more details), 2.35 Å
SCOPe Domain Sequences for d4gs7c1:
Sequence; same for both SEQRES and ATOM records: (download)
>d4gs7c1 b.1.2.1 (C:33-129) Cytokine receptor common gamma chain {Human (Homo sapiens) [TaxId: 9606]} lplpevqcfvfnveymnctwqsssepqptnltlhywyknsdndkvqkcshylfseeitsg cqlqkkeihlyqtfvvqlqdpreprrqatqmlklqnl
Timeline for d4gs7c1: