Lineage for d4gs7c1 (4gs7 C:33-129)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2761681Superfamily b.1.2: Fibronectin type III [49265] (2 families) (S)
  5. 2761682Family b.1.2.1: Fibronectin type III [49266] (45 proteins)
    Pfam PF00041
  6. 2761714Protein Cytokine receptor common gamma chain [141041] (1 species)
  7. 2761715Species Human (Homo sapiens) [TaxId:9606] [141042] (6 PDB entries)
    Uniprot P31785 142-246! Uniprot P31785 142-248! Uniprot P31785 54-141! Uniprot P31785 56-141
  8. 2761716Domain d4gs7c1: 4gs7 C:33-129 [202295]
    Other proteins in same PDB: d4gs7a1, d4gs7a2, d4gs7b1, d4gs7b2, d4gs7c3, d4gs7d_
    automated match to d2b5ic2
    complexed with act, edo, nag

Details for d4gs7c1

PDB Entry: 4gs7 (more details), 2.35 Å

PDB Description: structure of the interleukin-15 quaternary complex
PDB Compounds: (C:) Cytokine receptor common subunit gamma

SCOPe Domain Sequences for d4gs7c1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4gs7c1 b.1.2.1 (C:33-129) Cytokine receptor common gamma chain {Human (Homo sapiens) [TaxId: 9606]}
lplpevqcfvfnveymnctwqsssepqptnltlhywyknsdndkvqkcshylfseeitsg
cqlqkkeihlyqtfvvqlqdpreprrqatqmlklqnl

SCOPe Domain Coordinates for d4gs7c1:

Click to download the PDB-style file with coordinates for d4gs7c1.
(The format of our PDB-style files is described here.)

Timeline for d4gs7c1: