Lineage for d4gs7b2 (4gs7 B:104-207)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2761681Superfamily b.1.2: Fibronectin type III [49265] (2 families) (S)
  5. 2761682Family b.1.2.1: Fibronectin type III [49266] (45 proteins)
    Pfam PF00041
  6. 2762018Protein Interleukin-2 receptor beta chain [141047] (1 species)
  7. 2762019Species Human (Homo sapiens) [TaxId:9606] [141048] (4 PDB entries)
    Uniprot P14784 130-232! Uniprot P14784 130-233! Uniprot P14784 32-129
  8. 2762021Domain d4gs7b2: 4gs7 B:104-207 [202294]
    Other proteins in same PDB: d4gs7a1, d4gs7a2, d4gs7c1, d4gs7c2, d4gs7c3, d4gs7d_
    automated match to d2b5ib2
    complexed with act, edo, nag

Details for d4gs7b2

PDB Entry: 4gs7 (more details), 2.35 Å

PDB Description: structure of the interleukin-15 quaternary complex
PDB Compounds: (B:) Interleukin-2 receptor subunit beta

SCOPe Domain Sequences for d4gs7b2:

Sequence; same for both SEQRES and ATOM records: (download)

>d4gs7b2 b.1.2.1 (B:104-207) Interleukin-2 receptor beta chain {Human (Homo sapiens) [TaxId: 9606]}
lrlmapislqvvhvethrcnisweisqashyferhlefeartlspghtweeaplltlkqk
qewicletltpdtqyefqvrvkplqgefttwspwsqplafrtkp

SCOPe Domain Coordinates for d4gs7b2:

Click to download the PDB-style file with coordinates for d4gs7b2.
(The format of our PDB-style files is described here.)

Timeline for d4gs7b2: