![]() | Class b: All beta proteins [48724] (180 folds) |
![]() | Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
![]() | Superfamily b.1.2: Fibronectin type III [49265] (2 families) ![]() |
![]() | Family b.1.2.1: Fibronectin type III [49266] (45 proteins) Pfam PF00041 |
![]() | Protein Interleukin-2 receptor beta chain [141047] (1 species) |
![]() | Species Human (Homo sapiens) [TaxId:9606] [141048] (4 PDB entries) Uniprot P14784 130-232! Uniprot P14784 130-233! Uniprot P14784 32-129 |
![]() | Domain d4gs7b2: 4gs7 B:104-207 [202294] Other proteins in same PDB: d4gs7a1, d4gs7a2, d4gs7c1, d4gs7c2, d4gs7c3, d4gs7d_ automated match to d2b5ib2 complexed with act, edo, nag |
PDB Entry: 4gs7 (more details), 2.35 Å
SCOPe Domain Sequences for d4gs7b2:
Sequence; same for both SEQRES and ATOM records: (download)
>d4gs7b2 b.1.2.1 (B:104-207) Interleukin-2 receptor beta chain {Human (Homo sapiens) [TaxId: 9606]} lrlmapislqvvhvethrcnisweisqashyferhlefeartlspghtweeaplltlkqk qewicletltpdtqyefqvrvkplqgefttwspwsqplafrtkp
Timeline for d4gs7b2: