Lineage for d4gs7b1 (4gs7 B:6-103)

  1. Root: SCOPe 2.06
  2. 2021373Class b: All beta proteins [48724] (177 folds)
  3. 2021374Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2035676Superfamily b.1.2: Fibronectin type III [49265] (2 families) (S)
  5. 2035677Family b.1.2.1: Fibronectin type III [49266] (45 proteins)
    Pfam PF00041
  6. 2036010Protein Interleukin-2 receptor beta chain [141047] (1 species)
  7. 2036011Species Human (Homo sapiens) [TaxId:9606] [141048] (4 PDB entries)
    Uniprot P14784 130-232! Uniprot P14784 130-233! Uniprot P14784 32-129
  8. 2036012Domain d4gs7b1: 4gs7 B:6-103 [202293]
    Other proteins in same PDB: d4gs7a1, d4gs7a2, d4gs7c1, d4gs7c2, d4gs7c3, d4gs7d_
    automated match to d2b5ib1
    complexed with act, edo, nag

Details for d4gs7b1

PDB Entry: 4gs7 (more details), 2.35 Å

PDB Description: structure of the interleukin-15 quaternary complex
PDB Compounds: (B:) Interleukin-2 receptor subunit beta

SCOPe Domain Sequences for d4gs7b1:

Sequence, based on SEQRES records: (download)

>d4gs7b1 b.1.2.1 (B:6-103) Interleukin-2 receptor beta chain {Human (Homo sapiens) [TaxId: 9606]}
sqftcfynsraqiscvwsqdgalqdtscqvhawpdrrrwqqtcellpvsqaswacnlilg
apdsqklttvdivtlrvlcregvrwrvmaiqdfkpfen

Sequence, based on observed residues (ATOM records): (download)

>d4gs7b1 b.1.2.1 (B:6-103) Interleukin-2 receptor beta chain {Human (Homo sapiens) [TaxId: 9606]}
sqftcfynsraqiscvwsqtscqvhawpdrrrwqqtcellpvsqaswacnlilgapdsqk
lttvdivtlrvlcregvrwrvmaiqdfkpfen

SCOPe Domain Coordinates for d4gs7b1:

Click to download the PDB-style file with coordinates for d4gs7b1.
(The format of our PDB-style files is described here.)

Timeline for d4gs7b1: