Class b: All beta proteins [48724] (111 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (17 superfamilies) |
Superfamily b.1.1: Immunoglobulin [48726] (6 families) |
Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (14 proteins) |
Protein Immunoglobulin (variable domains of L and H chains) [48749] (222 species) |
Species Fab Desire-1 (mouse), kappa L chain [48846] (1 PDB entry) |
Domain d1kb5h1: 1kb5 H:1-113 [20229] Other proteins in same PDB: d1kb5a_, d1kb5b_, d1kb5h2, d1kb5l2 |
PDB Entry: 1kb5 (more details), 2.5 Å
SCOP Domain Sequences for d1kb5h1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1kb5h1 b.1.1.1 (H:1-113) Immunoglobulin (variable domains of L and H chains) {Fab Desire-1 (mouse), kappa L chain} evqlqqsgpelekpgasvkisckasgysftgynmnwvkqsngkslewignidpyyggisy nqkfkgratltvdkssstaymqlksltsedsavyycarsrtdlyyfdywgqgttltvss
Timeline for d1kb5h1:
View in 3D Domains from other chains: (mouse over for more information) d1kb5a_, d1kb5b_, d1kb5l1, d1kb5l2 |