Lineage for d1kb5h1 (1kb5 H:1-113)

  1. Root: SCOP 1.57
  2. 51639Class b: All beta proteins [48724] (104 folds)
  3. 51640Fold b.1: Immunoglobulin-like beta-sandwich [48725] (14 superfamilies)
  4. 51641Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 51642Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (14 proteins)
  6. 51698Protein Immunoglobulin (variable domains of L and H chains) [48749] (195 species)
  7. 52334Species Fab Desire-1 (mouse), kappa L chain [48846] (1 PDB entry)
  8. 52335Domain d1kb5h1: 1kb5 H:1-113 [20229]
    Other proteins in same PDB: d1kb5a_, d1kb5b_, d1kb5h2, d1kb5l2

Details for d1kb5h1

PDB Entry: 1kb5 (more details), 2.5 Å

PDB Description: murine t-cell receptor variable domain/fab complex

SCOP Domain Sequences for d1kb5h1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1kb5h1 b.1.1.1 (H:1-113) Immunoglobulin (variable domains of L and H chains) {Fab Desire-1 (mouse), kappa L chain}
evqlqqsgpelekpgasvkisckasgysftgynmnwvkqsngkslewignidpyyggisy
nqkfkgratltvdkssstaymqlksltsedsavyycarsrtdlyyfdywgqgttltvss

SCOP Domain Coordinates for d1kb5h1:

Click to download the PDB-style file with coordinates for d1kb5h1.
(The format of our PDB-style files is described here.)

Timeline for d1kb5h1: