Lineage for d4gqsa1 (4gqs A:29-489)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 2004931Fold a.104: Cytochrome P450 [48263] (1 superfamily)
    multihelical
  4. 2004932Superfamily a.104.1: Cytochrome P450 [48264] (2 families) (S)
  5. 2004933Family a.104.1.1: Cytochrome P450 [48265] (23 protein domains)
  6. 2005432Protein automated matches [190068] (9 species)
    not a true protein
  7. 2005449Species Human (Homo sapiens) [TaxId:9606] [189507] (40 PDB entries)
  8. 2005481Domain d4gqsa1: 4gqs A:29-489 [202288]
    Other proteins in same PDB: d4gqsa2, d4gqsb2, d4gqsc2, d4gqsd2
    automated match to d4gqsb_
    complexed with 0xv, gol, hem

Details for d4gqsa1

PDB Entry: 4gqs (more details), 2.87 Å

PDB Description: Structure of Human Microsomal Cytochrome P450 (CYP) 2C19
PDB Compounds: (A:) Cytochrome P450 2C19

SCOPe Domain Sequences for d4gqsa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4gqsa1 a.104.1.1 (A:29-489) automated matches {Human (Homo sapiens) [TaxId: 9606]}
lppgptplpvignilqidikdvsksltnlskiygpvftlyfglermvvlhgyevvkeali
dlgeefsgrghfplaeranrgfgivfsngkrwkeirrfslmtlrnfgmgkrsiedrvqee
arclveelrktkaspcdptfilgcapcnvicsiifqkrfdykdqqflnlmeklneniriv
stpwiqicnnfptiidyfpgthnkllknlafmesdilekvkehqesmdinnprdfidcfl
ikmekekqnqqseftienlvitaadllgagtettsttlryalllllkhpevtakvqeeie
rvvgrnrspcmqdrghmpytdavvhevqryidliptslphavtcdvkfrnylipkgttil
tsltsvlhdnkefpnpemfdprhfldeggnfkksnyfmpfsagkricvgeglarmelflf
ltfilqnfnlkslidpkdldttpvvngfasvppfyqlcfip

SCOPe Domain Coordinates for d4gqsa1:

Click to download the PDB-style file with coordinates for d4gqsa1.
(The format of our PDB-style files is described here.)

Timeline for d4gqsa1: