![]() | Class a: All alpha proteins [46456] (290 folds) |
![]() | Fold a.104: Cytochrome P450 [48263] (1 superfamily) multihelical |
![]() | Superfamily a.104.1: Cytochrome P450 [48264] (2 families) ![]() |
![]() | Family a.104.1.1: Cytochrome P450 [48265] (23 proteins) |
![]() | Protein automated matches [190068] (12 species) not a true protein |
![]() | Species Human (Homo sapiens) [TaxId:9606] [189507] (94 PDB entries) |
![]() | Domain d4gqsa1: 4gqs A:29-489 [202288] Other proteins in same PDB: d4gqsa2, d4gqsb2, d4gqsc2, d4gqsd2 automated match to d4gqsb_ complexed with 0xv, gol, hem |
PDB Entry: 4gqs (more details), 2.87 Å
SCOPe Domain Sequences for d4gqsa1:
Sequence; same for both SEQRES and ATOM records: (download)
>d4gqsa1 a.104.1.1 (A:29-489) automated matches {Human (Homo sapiens) [TaxId: 9606]} lppgptplpvignilqidikdvsksltnlskiygpvftlyfglermvvlhgyevvkeali dlgeefsgrghfplaeranrgfgivfsngkrwkeirrfslmtlrnfgmgkrsiedrvqee arclveelrktkaspcdptfilgcapcnvicsiifqkrfdykdqqflnlmeklneniriv stpwiqicnnfptiidyfpgthnkllknlafmesdilekvkehqesmdinnprdfidcfl ikmekekqnqqseftienlvitaadllgagtettsttlryalllllkhpevtakvqeeie rvvgrnrspcmqdrghmpytdavvhevqryidliptslphavtcdvkfrnylipkgttil tsltsvlhdnkefpnpemfdprhfldeggnfkksnyfmpfsagkricvgeglarmelflf ltfilqnfnlkslidpkdldttpvvngfasvppfyqlcfip
Timeline for d4gqsa1: