Lineage for d4gqfb1 (4gqf B:5-164)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2484063Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
    core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest
  4. 2484064Superfamily c.47.1: Thioredoxin-like [52833] (24 families) (S)
  5. 2485379Family c.47.1.10: Glutathione peroxidase-like [52901] (29 proteins)
  6. 2485529Protein Bacterioferritin comigratory protein [142377] (1 species)
  7. 2485530Species Aeropyrum pernix [TaxId:56636] [142378] (4 PDB entries)
    Uniprot Q9YA14 4-163
  8. 2485536Domain d4gqfb1: 4gqf B:5-164 [202287]
    Other proteins in same PDB: d4gqfa2, d4gqfb2
    automated match to d4gqfa_
    complexed with gol, so4

Details for d4gqfb1

PDB Entry: 4gqf (more details), 2.3 Å

PDB Description: Aeropyrum pernix Peroxiredoxin Q Enzyme in the Locally Unfolded Conformation
PDB Compounds: (B:) Thiol Peroxidase

SCOPe Domain Sequences for d4gqfb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4gqfb1 c.47.1.10 (B:5-164) Bacterioferritin comigratory protein {Aeropyrum pernix [TaxId: 56636]}
velgekapdftlpnqdfepvnlyevlkrgrpavliffpaafspvctkelctfrdkmaqle
kanaevlaisvdspwclkkfkdenrlafnllsdynreviklynvyhedlkglkmvakrav
fivkpdgtvaykwvtdnplnepdydevvreankiagelva

SCOPe Domain Coordinates for d4gqfb1:

Click to download the PDB-style file with coordinates for d4gqfb1.
(The format of our PDB-style files is described here.)

Timeline for d4gqfb1:

View in 3D
Domains from same chain:
(mouse over for more information)
d4gqfb2