Lineage for d4gqcc1 (4gqc C:5-163)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2876126Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
    core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest
  4. 2876127Superfamily c.47.1: Thioredoxin-like [52833] (24 families) (S)
  5. 2877441Family c.47.1.10: Glutathione peroxidase-like [52901] (29 proteins)
  6. 2877586Protein Bacterioferritin comigratory protein [142377] (1 species)
  7. 2877587Species Aeropyrum pernix [TaxId:56636] [142378] (4 PDB entries)
    Uniprot Q9YA14 4-163
  8. 2877590Domain d4gqcc1: 4gqc C:5-163 [202286]
    Other proteins in same PDB: d4gqca2, d4gqcb2, d4gqcc2, d4gqcd2
    automated match to d2cx4a_
    complexed with dtd, gol, so4

Details for d4gqcc1

PDB Entry: 4gqc (more details), 2 Å

PDB Description: Crystal Structure of Aeropyrum pernix Peroxiredoxin Q Enzyme in Fully-Folded and Locally-Unfolded Conformations
PDB Compounds: (C:) Thiol Peroxidase

SCOPe Domain Sequences for d4gqcc1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4gqcc1 c.47.1.10 (C:5-163) Bacterioferritin comigratory protein {Aeropyrum pernix [TaxId: 56636]}
velgekapdftlpnqdfepvnlyevlkrgrpavliffpaafspvctkelctfrdkmaqle
kanaevlaisvdspwclkkfkdenrlafnllsdynreviklynvyhedlkglkmvakrav
fivkpdgtvaykwvtdnplnepdydevvreankiagelv

SCOPe Domain Coordinates for d4gqcc1:

Click to download the PDB-style file with coordinates for d4gqcc1.
(The format of our PDB-style files is described here.)

Timeline for d4gqcc1: