SCOPe 2.03: Domain d4gqcb_: 4gqc B:

Lineage for d4gqcb_ (4gqc B:)

1. Root: SCOPe 2.03

2. Class c: Alpha and beta proteins (a/b) [51349] (147 folds)

3. Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
   core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest

4. Superfamily c.47.1: Thioredoxin-like [52833] (24 families)

5. Family c.47.1.10: Glutathione peroxidase-like [52901] (29 proteins)

6. Protein Bacterioferritin comigratory protein [142377] (1 species)

7. Species Aeropyrum pernix [TaxId:56636] [142378] (4 PDB entries)
   Uniprot Q9YA14 4-163

8. Domain d4gqcb_: 4gqc B: [202285]
   automated match to d2cx3a1
   complexed with dtd, gol, so4

Details for d4gqcb_

PDB Entry: 4gqc, 2 Å

PDB Description: Crystal Structure of Aeropyrum pernix Peroxiredoxin Q Enzyme in Fully-Folded and Locally-Unfolded Conformations

PDB Compounds: (B:) Thiol Peroxidase

SCOPe Domain Sequences for d4gqcb_:

Sequence; same for both SEQRES and ATOM records:

>d4gqcb_ c.47.1.10 (B:) Bacterioferritin comigratory protein {Aeropyrum pernix [TaxId: 56636]}
lvelgekapdftlpnqdfepvnlyevlkrgrpavliffpaafspvctkelctfrdkmaql
ekanaevlaisvdspwclkkfkdenrlafnllsdynreviklynvyhedlkglkmvakra
vfivkpdgtvaykwvtdnplnepdydevvreankiagelv

Timeline for d4gqcb_:

• d4gqcb_ is new in SCOPe 2.03-stable
  
• d4gqcb_ appears in SCOPe 2.04
  
• d4gqcb_ appears in the current release, SCOPe 2.08, called d4gqcb1