SCOPe 2.08: Domain d4gpna1: 4gpn A:1-477

Lineage for d4gpna1 (4gpn A:1-477)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.1: TIM beta/alpha-barrel [51350] (34 superfamilies)
   contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
   the first seven superfamilies have similar phosphate-binding sites

4. Superfamily c.1.8: (Trans)glycosidases [51445] (15 families)

5. Family c.1.8.0: automated matches [191314] (1 protein)
   not a true family

6. Protein automated matches [190075] (132 species)
   not a true protein

7. Species Streptococcus mutans [TaxId:210007] [194595] (4 PDB entries)

8. Domain d4gpna1: 4gpn A:1-477 [202281]
   Other proteins in same PDB: d4gpna2
   automated match to d4gpnb_
   complexed with gol, trs; mutant

Details for d4gpna1

PDB Entry: 4gpn, 2.29 Å

PDB Description: the crystal structure of 6-p-beta-d-glucosidase (e375q mutant) from streptococcus mutans ua150 in complex with gentiobiose 6-phosphate.

PDB Compounds: (A:) 6-phospho-beta-D-Glucosidase

SCOPe Domain Sequences for d4gpna1:

Sequence; same for both SEQRES and ATOM records:

>d4gpna1 c.1.8.0 (A:1-477) automated matches {Streptococcus mutans [TaxId: 210007]}
msklpenflwggavaahqleggwqeggkgisvadvmtagrhgvareitagvlegkyypnh
eaidfyhhykedvklfaemgfkcfrtsiawtrifpkgdeaepneaglqfyddlfdeclky
giepvvtlshfelpyhlvteyggftnrkvidffvhfaevcfrrykdkvkywmtfneinnq
anyqedfapftnsgivykegddreaimyqaahyelvasaravkighainpnlnigcmvam
cpiypatcnpkdilmaqkamqkryyfadvhvhgfypehifkywerkaikvdfterdkkdl
fegtvdyigfsyymsfvidahrennpyydyletedlvknpyvkasdwdwqidpqglryal
nwftdmyhlplfivqngfgaidqveadgmvhddyridylgahikemikavdedgvelmgy
tpwgcidlvsagtgemrkrygfiyvdkddegkgtlkrspklsfnwykeviasngddi

Timeline for d4gpna1:

• d4gpna1 first appeared in SCOPe 2.03, called d4gpna_
  
• d4gpna1 appears in SCOPe 2.07