SCOPe 2.08: Domain d4gojb_: 4goj B:

Lineage for d4gojb_ (4goj B:)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
   3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes

4. Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (27 families)
   division into families based on beta-sheet topologies

5. Family c.37.1.8: G proteins [52592] (81 proteins)
   core: mixed beta-sheet of 6 strands, order 231456; strand 2 is antiparallel to the rest

6. Protein ADP-ribosylation factor [52614] (17 species)

7. Species Mouse (Mus musculus), ARL3 [TaxId:10090] [52618] (3 PDB entries)

8. Domain d4gojb_: 4goj B: [202280]
   automated match to d4goja_
   complexed with gnp, mg

Details for d4gojb_

PDB Entry: 4goj, 2.1 Å

PDB Description: The Crystal Structure of full length Arl3GppNHp in complex with UNC119a

PDB Compounds: (B:) ADP-ribosylation factor-like protein 3

SCOPe Domain Sequences for d4gojb_:

Sequence; same for both SEQRES and ATOM records:

>d4gojb_ c.37.1.8 (B:) ADP-ribosylation factor {Mouse (Mus musculus), ARL3 [TaxId: 10090]}
gllsilrklksapdqevrilllgldnagkttllkqlasedishitptqgfniksvqsqgf
klnvwdiggqrkirpywrsyfentdiliyvidsadrkrfeetgqeltelleeeklscvpv
lifankqdlltaapaseiaeglnlhtirdrvwqiqscsaltgegvqdgmnwvcknv

Timeline for d4gojb_:

• d4gojb_ first appeared in SCOPe 2.03
  
• d4gojb_ appears in SCOPe 2.07