SCOPe 2.08: Domain d4gmxa_: 4gmx A:

Lineage for d4gmxa_ (4gmx A:)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
   3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes

4. Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (27 families)
   division into families based on beta-sheet topologies

5. Family c.37.1.8: G proteins [52592] (81 proteins)
   core: mixed beta-sheet of 6 strands, order 231456; strand 2 is antiparallel to the rest

6. Protein Ran [52609] (2 species)

7. Species Human (Homo sapiens) [TaxId:9606] [52611] (90 PDB entries)

8. Domain d4gmxa_: 4gmx A: [202279]
   Other proteins in same PDB: d4gmxb_
   automated match to d4hb3a_
   complexed with cl, edo, gnp, gol, k85, mg
   has additional insertions and/or extensions that are not grouped together

Details for d4gmxa_

PDB Entry: 4gmx, 2.1 Å

PDB Description: Crystal structure of KPT185 in complex with CRM1-Ran-RanBP1

PDB Compounds: (A:) GTP-binding nuclear protein ran

SCOPe Domain Sequences for d4gmxa_:

Sequence, based on SEQRES records:

>d4gmxa_ c.37.1.8 (A:) Ran {Human (Homo sapiens) [TaxId: 9606]}
qvqfklvlvgdggtgkttfvkrhltgefekkyvatlgvevhplvfhtnrgpikfnvwdta
gqekfgglrdgyyiqaqcaiimfdvtsrvtyknvpnwhrdlvrvcenipivlcgnkvdik
drkvkaksivfhrkknlqyydisaksnynfekpflwlarkligdpnlefvampalappev
vmdpalaaqyehdlevaqttalpdedddl

Sequence, based on observed residues (ATOM records):

>d4gmxa_ c.37.1.8 (A:) Ran {Human (Homo sapiens) [TaxId: 9606]}
qvqfklvlvgdggtgkttfvkrhltgefekkyvatlgvevhplvfhtnrgpikfnvwdta
gqekfgglrdgyyiqaqcaiimfdvtsrvtyknvpnwhrdlvrvcenipivlcgnkvdik
drkvkaksivfhrkknlqyydisaksnynfekpflwlarkligdpnlefvampalappev
vlaaqyehdlevaqttalpdedddl

Timeline for d4gmxa_:

• d4gmxa_ first appeared in SCOPe 2.03
  
• d4gmxa_ appears in SCOPe 2.07