SCOPe 2.06: Domain d4glmd1: 4glm D:246-301

Lineage for d4glmd1 (4glm D:246-301)

1. Root: SCOPe 2.06

2. Class b: All beta proteins [48724] (177 folds)

3. Fold b.34: SH3-like barrel [50036] (21 superfamilies)
   barrel, partly opened; n*=4, S*=8; meander
   the last strand is interrupted by a turn of 3-10 helix

4. Superfamily b.34.2: SH3-domain [50044] (2 families)

5. Family b.34.2.0: automated matches [191375] (1 protein)
   not a true family

6. Protein automated matches [190457] (10 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187598] (90 PDB entries)

8. Domain d4glmd1: 4glm D:246-301 [202277]
   Other proteins in same PDB: d4glma2, d4glma3, d4glmb2, d4glmd2
   automated match to d4glmc_
   complexed with unx

Details for d4glmd1

PDB Entry: 4glm, 1.9 Å

PDB Description: Crystal structure of the SH3 Domain of DNMBP protein [Homo sapiens]

PDB Compounds: (D:) Dynamin-binding protein

SCOPe Domain Sequences for d4glmd1:

Sequence; same for both SEQRES and ATOM records:

>d4glmd1 b.34.2.0 (D:246-301) automated matches {Human (Homo sapiens) [TaxId: 9606]}
tygvalyrfqalepneldfevgdkirilatledgwlegslkgrtgifpyrfvklcp

Timeline for d4glmd1:

• d4glmd1 first appeared in SCOPe 2.03, called d4glmd_
  
• d4glmd1 was called d4glmd_ in SCOPe 2.05
  
• d4glmd1 appears in SCOPe 2.07
  
• d4glmd1 appears in the current release, SCOPe 2.08