Lineage for d4glmb1 (4glm B:246-301)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2392350Fold b.34: SH3-like barrel [50036] (21 superfamilies)
    barrel, partly opened; n*=4, S*=8; meander
    the last strand is interrupted by a turn of 3-10 helix
  4. 2392486Superfamily b.34.2: SH3-domain [50044] (2 families) (S)
  5. 2392985Family b.34.2.0: automated matches [191375] (1 protein)
    not a true family
  6. 2392986Protein automated matches [190457] (10 species)
    not a true protein
  7. 2393062Species Human (Homo sapiens) [TaxId:9606] [187598] (102 PDB entries)
  8. 2393092Domain d4glmb1: 4glm B:246-301 [202276]
    Other proteins in same PDB: d4glma2, d4glma3, d4glmb2, d4glmd2
    automated match to d4glmc_
    complexed with unx

Details for d4glmb1

PDB Entry: 4glm (more details), 1.9 Å

PDB Description: Crystal structure of the SH3 Domain of DNMBP protein [Homo sapiens]
PDB Compounds: (B:) Dynamin-binding protein

SCOPe Domain Sequences for d4glmb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4glmb1 b.34.2.0 (B:246-301) automated matches {Human (Homo sapiens) [TaxId: 9606]}
tygvalyrfqalepneldfevgdkirilatledgwlegslkgrtgifpyrfvklcp

SCOPe Domain Coordinates for d4glmb1:

Click to download the PDB-style file with coordinates for d4glmb1.
(The format of our PDB-style files is described here.)

Timeline for d4glmb1: