Lineage for d4gkxf_ (4gkx F:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2778274Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily)
    sandwich; 12-14 strands in 2 sheets; complex topology
  4. 2778275Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (27 families) (S)
  5. 2780347Family b.29.1.13: Lectin leg-like [74904] (4 proteins)
    mammalian protein related to legume lectins
    automatically mapped to Pfam PF03388
  6. 2780369Protein automated matches [190462] (2 species)
    not a true protein
  7. 2780375Species Human (Homo sapiens) [TaxId:9606] [197238] (11 PDB entries)
  8. 2780389Domain d4gkxf_: 4gkx F: [202274]
    automated match to d4gkxb_
    complexed with ca, gol

Details for d4gkxf_

PDB Entry: 4gkx (more details), 2.7 Å

PDB Description: crystal structure of a carbohydrate-binding domain
PDB Compounds: (F:) Protein ERGIC-53

SCOPe Domain Sequences for d4gkxf_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4gkxf_ b.29.1.13 (F:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
lphrrfeykysfkgphlvqsdgtvpfwahagnaipssdqirvapslksqrgsvwtktkaa
fenwevevtfrvtgrgrigadglaiwyaenqglegpvfgsadlwngvgiffdsfdndgkk
nnpaiviignngqihydhqndgasqalascqrdfrnkpypvrakityyqntltvminngf
tpdkndyefcakvenmiipaqghfgisaatggladdhdvlsfltfqltep

SCOPe Domain Coordinates for d4gkxf_:

Click to download the PDB-style file with coordinates for d4gkxf_.
(The format of our PDB-style files is described here.)

Timeline for d4gkxf_: