SCOPe 2.05: Domain d4gkxc_: 4gkx C:

Lineage for d4gkxc_ (4gkx C:)

1. Root: SCOPe 2.05

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily)
   sandwich; 12-14 strands in 2 sheets; complex topology

4. Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (26 families)

5. Family b.29.1.13: Lectin leg-like [74904] (4 proteins)
   mammalian protein related to legume lectins
   automatically mapped to Pfam PF03388

6. Protein automated matches [190462] (2 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [197238] (7 PDB entries)

8. Domain d4gkxc_: 4gkx C: [202271]
   automated match to d4gkxb_
   complexed with 2m4, ca, gol

Details for d4gkxc_

PDB Entry: 4gkx, 2.7 Å

PDB Description: crystal structure of a carbohydrate-binding domain

PDB Compounds: (C:) Protein ERGIC-53

SCOPe Domain Sequences for d4gkxc_:

Sequence; same for both SEQRES and ATOM records:

>d4gkxc_ b.29.1.13 (C:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
lphrrfeykysfkgphlvqsdgtvpfwahagnaipssdqirvapslksqrgsvwtktkaa
fenwevevtfrvtgrgrigadglaiwyaenqglegpvfgsadlwngvgiffdsfdndgkk
nnpaiviignngqihydhqndgasqalascqrdfrnkpypvrakityyqntltvminngf
tpdkndyefcakvenmiipaqghfgisaatggladdhdvlsfltfqltep

Timeline for d4gkxc_:

• d4gkxc_ first appeared in SCOPe 2.03
  
• d4gkxc_ appears in SCOPe 2.04
  
• d4gkxc_ appears in SCOPe 2.06
  
• d4gkxc_ appears in the current release, SCOPe 2.08