SCOPe 2.06: Domain d1gpoi1: 1gpo I:1-113

Lineage for d1gpoi1 (1gpo I:1-113)

1. Root: SCOPe 2.06

2. Class b: All beta proteins [48724] (177 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)

6. Protein Immunoglobulin heavy chain variable domain, VH [88543] (22 species)
   VH domains of human and mouse antibodies are clustered by the sequence similarity within the germline encoded segment and then by the size of the complementarity determining regions CDR1 and CDR2, so the clusters may correspond to putative germline families in the species genomes; VH domains with artificial or grafted exogenous CDRs are listed as engineered species

7. Species Engineered (including hybrid species) [88562] (68 PDB entries)
   SQ NA # humanized antidoby; bactericidal Fab-h6831 ! SQ NA # humanized antibody ! SQ NA # Humanized antibody ! SQ NA # engineered antibody

8. Domain d1gpoi1: 1gpo I:1-113 [20227]
   Other proteins in same PDB: d1gpoh2, d1gpoi2, d1gpol1, d1gpol2, d1gpom1, d1gpom2
   part of Fab M41 (artificial design)
   complexed with so4

Details for d1gpoi1

PDB Entry: 1gpo, 1.95 Å

PDB Description: crystal structure of the rationally designed antibody m41 as a fab fragment

PDB Compounds: (I:) antibody m41

SCOPe Domain Sequences for d1gpoi1:

Sequence; same for both SEQRES and ATOM records:

>d1gpoi1 b.1.1.1 (I:1-113) Immunoglobulin heavy chain variable domain, VH {Engineered (including hybrid species)}
evklqesgpslvkpsqtlsltcsvtgdsitsdfwswirqfpgnrleymgfvqysgetayn
pslksrisitrdtsknqyyldlnsvttedtavyycanwhgdywgqgttvtvss

Timeline for d1gpoi1:

• d1gpoi1 first appeared (with stable ids) in SCOP 1.55
  
• d1gpoi1 appears in SCOPe 2.05
  
• d1gpoi1 appears in SCOPe 2.07
  
• d1gpoi1 appears in the current release, SCOPe 2.08