Lineage for d1gpoi1 (1gpo I:1-113)

  1. Root: SCOP 1.63
  2. 218896Class b: All beta proteins [48724] (119 folds)
  3. 218897Fold b.1: Immunoglobulin-like beta-sandwich [48725] (20 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 218898Superfamily b.1.1: Immunoglobulin [48726] (4 families) (S)
  5. 218899Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (15 proteins)
  6. 218958Protein Immunoglobulin (variable domains of L and H chains) [48749] (228 species)
  7. 219845Species Fab M41 (artificial design) [48845] (1 PDB entry)
  8. 219847Domain d1gpoi1: 1gpo I:1-113 [20227]
    Other proteins in same PDB: d1gpoh2, d1gpoi2, d1gpol2, d1gpom2
    complexed with so4

Details for d1gpoi1

PDB Entry: 1gpo (more details), 1.95 Å

PDB Description: crystal structure of the rationally designed antibody m41 as a fab fragment

SCOP Domain Sequences for d1gpoi1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1gpoi1 b.1.1.1 (I:1-113) Immunoglobulin (variable domains of L and H chains) {Fab M41 (artificial design)}
evklqesgpslvkpsqtlsltcsvtgdsitsdfwswirqfpgnrleymgfvqysgetayn
pslksrisitrdtsknqyyldlnsvttedtavyycanwhgdywgqgttvtvss

SCOP Domain Coordinates for d1gpoi1:

Click to download the PDB-style file with coordinates for d1gpoi1.
(The format of our PDB-style files is described here.)

Timeline for d1gpoi1: