![]() | Class b: All beta proteins [48724] (119 folds) |
![]() | Fold b.1: Immunoglobulin-like beta-sandwich [48725] (20 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
![]() | Superfamily b.1.1: Immunoglobulin [48726] (4 families) ![]() |
![]() | Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (15 proteins) |
![]() | Protein Immunoglobulin (variable domains of L and H chains) [48749] (228 species) |
![]() | Species Fab M41 (artificial design) [48845] (1 PDB entry) |
![]() | Domain d1gpoi1: 1gpo I:1-113 [20227] Other proteins in same PDB: d1gpoh2, d1gpoi2, d1gpol2, d1gpom2 complexed with so4 |
PDB Entry: 1gpo (more details), 1.95 Å
SCOP Domain Sequences for d1gpoi1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1gpoi1 b.1.1.1 (I:1-113) Immunoglobulin (variable domains of L and H chains) {Fab M41 (artificial design)} evklqesgpslvkpsqtlsltcsvtgdsitsdfwswirqfpgnrleymgfvqysgetayn pslksrisitrdtsknqyyldlnsvttedtavyycanwhgdywgqgttvtvss
Timeline for d1gpoi1: