Class b: All beta proteins [48724] (111 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (17 superfamilies) |
Superfamily b.1.1: Immunoglobulin [48726] (6 families) |
Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (14 proteins) |
Protein Immunoglobulin (variable domains of L and H chains) [48749] (222 species) |
Species Fab M41 (artificial design) [48845] (1 PDB entry) |
Domain d1gpoi1: 1gpo I:1-113 [20227] Other proteins in same PDB: d1gpoh2, d1gpoi2, d1gpol2, d1gpom2 |
PDB Entry: 1gpo (more details), 1.95 Å
SCOP Domain Sequences for d1gpoi1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1gpoi1 b.1.1.1 (I:1-113) Immunoglobulin (variable domains of L and H chains) {Fab M41 (artificial design)} evklqesgpslvkpsqtlsltcsvtgdsitsdfwswirqfpgnrleymgfvqysgetayn pslksrisitrdtsknqyyldlnsvttedtavyycanwhgdywgqgttvtvss
Timeline for d1gpoi1: