SCOP 1.61: Domain d1gpoi1: 1gpo I:1-113

Lineage for d1gpoi1 (1gpo I:1-113)

1. Root: SCOP 1.61

2. Class b: All beta proteins [48724] (111 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (17 superfamilies)

4. Superfamily b.1.1: Immunoglobulin [48726] (6 families)

5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (14 proteins)

6. Protein Immunoglobulin (variable domains of L and H chains) [48749] (222 species)

7. Species Fab M41 (artificial design) [48845] (1 PDB entry)

8. Domain d1gpoi1: 1gpo I:1-113 [20227]
   Other proteins in same PDB: d1gpoh2, d1gpoi2, d1gpol2, d1gpom2

Details for d1gpoi1

PDB Entry: 1gpo, 1.95 Å

PDB Description: crystal structure of the rationally designed antibody m41 as a fab fragment

SCOP Domain Sequences for d1gpoi1:

Sequence; same for both SEQRES and ATOM records:

>d1gpoi1 b.1.1.1 (I:1-113) Immunoglobulin (variable domains of L and H chains) {Fab M41 (artificial design)}
evklqesgpslvkpsqtlsltcsvtgdsitsdfwswirqfpgnrleymgfvqysgetayn
pslksrisitrdtsknqyyldlnsvttedtavyycanwhgdywgqgttvtvss

Timeline for d1gpoi1:

• d1gpoi1 first appeared (with stable ids) in SCOP 1.55
  
• d1gpoi1 appears in SCOP 1.59
  
• d1gpoi1 appears in SCOP 1.63
  
• d1gpoi1 appears in the current release, SCOPe 2.08