SCOPe 2.08: Domain d4gjqb_: 4gjq B:

Lineage for d4gjqb_ (4gjq B:)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.224: Glycolipid transfer protein, GLTP [110003] (1 superfamily)
   multihelical; 2 layers or orthogonally packed helices

4. Superfamily a.224.1: Glycolipid transfer protein, GLTP [110004] (1 family)

5. Family a.224.1.1: Glycolipid transfer protein, GLTP [110005] (2 proteins)

6. Protein Glycolipid transfer protein, GLTP [110006] (2 species)

7. Species Human (Homo sapiens) [TaxId:9606] [110007] (20 PDB entries)
   Uniprot Q9NZD2

8. Domain d4gjqb_: 4gjq B: [202269]
   automated match to d1swxa_
   complexed with cis, hex

Details for d4gjqb_

PDB Entry: 4gjq, 2 Å

PDB Description: Crystal structure of human GLTP bound with 12:0 monosulfatide (orthorhombic form;two subunits in asymmetric unit)

PDB Compounds: (B:) glycolipid transfer protein

SCOPe Domain Sequences for d4gjqb_:

Sequence; same for both SEQRES and ATOM records:

>d4gjqb_ a.224.1.1 (B:) Glycolipid transfer protein, GLTP {Human (Homo sapiens) [TaxId: 9606]}
llkplpadkqietgpfleavshlppffdclgspvftpikadisgnitkikavydtnpakf
rtlqnilevekemygaewpkvgatlalmwlkrglrfiqvflqsicdgerdenhpnlirvn
atkayemalkkyhgwivqkifqaalyaapyksdflkalskgqnvteeeclekirlflvny
tatidviyemytqmnaelnykv

Timeline for d4gjqb_:

• d4gjqb_ first appeared in SCOPe 2.03
  
• d4gjqb_ appears in SCOPe 2.07