| Class a: All alpha proteins [46456] (290 folds) |
| Fold a.39: EF Hand-like [47472] (4 superfamilies) core: 4 helices; array of 2 hairpins, opened |
Superfamily a.39.1: EF-hand [47473] (12 families) ![]() Duplication: consists of two EF-hand units: each is made of two helices connected with calcium-binding loop |
| Family a.39.1.2: S100 proteins [47478] (2 proteins) dimer: subunits are made of two EF-hands |
| Protein automated matches [190132] (4 species) not a true protein |
| Species Human (Homo sapiens) [TaxId:9606] [187203] (41 PDB entries) |
| Domain d4ggfc_: 4ggf C: [202261] Other proteins in same PDB: d4ggfa_, d4ggfk_, d4ggfs_, d4ggfu_ automated match to d3nsib_ complexed with ca, gol, mn, so4 |
PDB Entry: 4ggf (more details), 1.6 Å
SCOPe Domain Sequences for d4ggfc_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4ggfc_ a.39.1.2 (C:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
kmsqlernietiintfhqysvklghpdtlnqgefkelvrkdlqnflkkenknekviehim
edldtnadkqlsfeefimlmarltwashekmhegdegpghhhkpglge
Timeline for d4ggfc_: