Lineage for d4gfsb_ (4gfs B:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2078560Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2085156Superfamily c.1.10: Aldolase [51569] (9 families) (S)
    Common fold covers whole protein structure
  5. 2085157Family c.1.10.1: Class I aldolase [51570] (13 protein domains)
    the catalytic lysine forms schiff-base intermediate with substrate
    possible link between the aldolase superfamily and the phosphate-binding beta/alpha barrels
  6. 2085665Protein automated matches [190095] (24 species)
    not a true protein
  7. 2085864Species Salmonella enterica [TaxId:99287] [189300] (4 PDB entries)
  8. 2085873Domain d4gfsb_: 4gfs B: [202260]
    automated match to d3m7wd_
    complexed with ni, sin

Details for d4gfsb_

PDB Entry: 4gfs (more details), 1.8 Å

PDB Description: 1.8 Angstrom Crystal Structure of the 3-Dehydroquinate Dehydratase (aroD) from Salmonella typhimurium LT2 with Nickel Bound at Active Site
PDB Compounds: (B:) 3-dehydroquinate dehydratase

SCOPe Domain Sequences for d4gfsb_:

Sequence, based on SEQRES records: (download)

>d4gfsb_ c.1.10.1 (B:) automated matches {Salmonella enterica [TaxId: 99287]}
mktvtvrdlvvgegapkiivslmgktitdvksealayreadfdilewrvdhfanvttaes
vleaagaireiitdkpllftfrsakeggeqalttgqyidlnraavdsglvdmidlelftg
ddevkatvgyahqhnvavimsnhdfhktpaaeeivqrlrkmqelgadipkiavmpqtkad
vltlltatvemqeryadrpiitmsmsktgvisrlagevfgsaatfgavkkasapgqisva
dlrtvltilhqa

Sequence, based on observed residues (ATOM records): (download)

>d4gfsb_ c.1.10.1 (B:) automated matches {Salmonella enterica [TaxId: 99287]}
mktvtvrdlvvgegapkiivslmgktitdvksealayreadfdilewrvdhfanvttaes
vleaagaireiitdkpllftfrsakeggeqalttgqyidlnraavdsglvdmidlelftg
ddevkatvgyahqhnvavimsnhdfhktpaaeeivqrlrkmqelgadipkiavmpqtkad
vltlltatvemqeryadrpiitmsmsktgvisrlagevfgsaatfgavkapgqisvadlr
tvltilhqa

SCOPe Domain Coordinates for d4gfsb_:

Click to download the PDB-style file with coordinates for d4gfsb_.
(The format of our PDB-style files is described here.)

Timeline for d4gfsb_: