Lineage for d4gezh_ (4gez H:)

  1. Root: SCOPe 2.07
  2. 2344607Class b: All beta proteins [48724] (178 folds)
  3. 2398193Fold b.68: 6-bladed beta-propeller [50938] (11 superfamilies)
    consists of six 4-stranded beta-sheet motifs; meander
  4. 2398194Superfamily b.68.1: Sialidases [50939] (3 families) (S)
  5. 2398637Family b.68.1.0: automated matches [191452] (1 protein)
    not a true family
  6. 2398638Protein automated matches [190692] (15 species)
    not a true protein
  7. 2398698Species Influenza A virus, different strains [TaxId:11320] [188445] (32 PDB entries)
  8. 2398746Domain d4gezh_: 4gez H: [202256]
    automated match to d4gezk_
    complexed with ca, fuc, nag

Details for d4gezh_

PDB Entry: 4gez (more details), 2.5 Å

PDB Description: Structure of a neuraminidase-like protein from A/bat/Guatemala/164/2009
PDB Compounds: (H:) Neuraminidase

SCOPe Domain Sequences for d4gezh_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4gezh_ b.68.1.0 (H:) automated matches {Influenza A virus, different strains [TaxId: 11320]}
ywraksqmcevkgwvpthrgfpwgpelpgdlilsrrayvscdltscfkffiayglsanqh
llntsmeweeslyktpigsastlstsemilpgrsssacfdglkwtvlvangrdrnsfimi
kygeevtdtfsasrggplrlpnseciciegscfvivsdgpnvnqsvhriyelqngtvqrw
kqlnttginfeystcytinnlikctgtnlwndakrpllrftkelnyqivepcngaptdfp
rgglttpsckmaqekgeggiqgfildekpawtsktkaessqngfvleqipngiesegtvs
lsyelfsnkrtgrsgffqpkgdlisgcqricfwleiedqtvglgmiqelstfcginspvq
ninwd

SCOPe Domain Coordinates for d4gezh_:

Click to download the PDB-style file with coordinates for d4gezh_.
(The format of our PDB-style files is described here.)

Timeline for d4gezh_: