SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d4geze_ (4gez E:)

  1. Root: SCOPe 2.06
  2. 2017114Class b: All beta proteins [48724] (177 folds)
  3. 2064980Fold b.68: 6-bladed beta-propeller [50938] (11 superfamilies)
    consists of six 4-stranded beta-sheet motifs; meander
  4. 2064981Superfamily b.68.1: Sialidases [50939] (3 families) (S)
  5. 2065391Family b.68.1.0: automated matches [191452] (1 protein)
    not a true family
  6. 2065392Protein automated matches [190692] (14 species)
    not a true protein
  7. 2065420Species Influenza A virus [TaxId:11320] [188445] (31 PDB entries)
  8. 2065465Domain d4geze_: 4gez E: [202253]
    automated match to d4gezk_
    complexed with ca, fuc, nag

Details for d4geze_

PDB Entry: 4gez (more details), 2.5 Å

PDB Description: Structure of a neuraminidase-like protein from A/bat/Guatemala/164/2009
PDB Compounds: (E:) Neuraminidase

SCOPe Domain Sequences for d4geze_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4geze_ b.68.1.0 (E:) automated matches {Influenza A virus [TaxId: 11320]}
ywraksqmcevkgwvpthrgfpwgpelpgdlilsrrayvscdltscfkffiayglsanqh
llntsmeweeslyktpigsastlstsemilpgrsssacfdglkwtvlvangrdrnsfimi
kygeevtdtfsasrggplrlpnseciciegscfvivsdgpnvnqsvhriyelqngtvqrw
kqlnttginfeystcytinnlikctgtnlwndakrpllrftkelnyqivepcngaptdfp
rgglttpsckmaqekgeggiqgfildekpawtsktkaessqngfvleqipngiesegtvs
lsyelfsnkrtgrsgffqpkgdlisgcqricfwleiedqtvglgmiqelstfcginspvq
ninwd

SCOPe Domain Coordinates for d4geze_:

Click to download the PDB-style file with coordinates for d4geze_.
(The format of our PDB-style files is described here.)

Timeline for d4geze_: