Lineage for d4gdic_ (4gdi C:)

  1. Root: SCOPe 2.07
  2. 2344607Class b: All beta proteins [48724] (178 folds)
  3. 2398193Fold b.68: 6-bladed beta-propeller [50938] (11 superfamilies)
    consists of six 4-stranded beta-sheet motifs; meander
  4. 2398194Superfamily b.68.1: Sialidases [50939] (3 families) (S)
  5. 2398637Family b.68.1.0: automated matches [191452] (1 protein)
    not a true family
  6. 2398638Protein automated matches [190692] (15 species)
    not a true protein
  7. 2398698Species Influenza A virus, different strains [TaxId:11320] [188445] (32 PDB entries)
  8. 2398717Domain d4gdic_: 4gdi C: [202242]
    automated match to d4gdib_
    complexed with ca, gol, nag, no3

Details for d4gdic_

PDB Entry: 4gdi (more details), 1.95 Å

PDB Description: A subtype N10 neuraminidase-like protein of A/little yellow-shouldered bat/Guatemala/164/2009
PDB Compounds: (C:) Neuraminidase

SCOPe Domain Sequences for d4gdic_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4gdic_ b.68.1.0 (C:) automated matches {Influenza A virus, different strains [TaxId: 11320]}
fywraksqmcevkgwvpthrgfpwgpelpgdlilsrrayvscdltscfkffiayglsanq
hllntsmeweeslyktpigsastlstsemilpgrsssacfdglkwtvlvangrdrnsfim
ikygeevtdtfsasrggplrlpnseciciegscfvivsdgpnvnqsvhriyelqngtvqr
wkqlnttginfeystcytinnlikctgtnlwndakrpllrftkelnyqivepcngaptdf
prgglttpsckmaqekgeggiqgfildekpawtsktkaessqngfvleqipngiesegtv
slsyelfsnkrtgrsgffqpkgdlisgcqricfwleiedqtvglgmiqelstfcginspv
qninwds

SCOPe Domain Coordinates for d4gdic_:

Click to download the PDB-style file with coordinates for d4gdic_.
(The format of our PDB-style files is described here.)

Timeline for d4gdic_: